PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676785544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family MIKC_MADS
Protein Properties Length: 204aa    MW: 23448.2 Da    PI: 8.9247
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676785544genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF801.6e-25958150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien  nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  676785544  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58
               79*********************************************997 PP

2K-box66.59.5e-2371165192
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn.ellleq..ieelqkkekelqeenk 92 
                yqk sgk+l++ak+esl++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R+++  ++l e+  +ee ++   +lq++++
  676785544  71 YQKLSGKKLWDAKHESLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVREHQAcRHLSEKmmVEENRQLSFQLQQQEM 165
                899****************************************************************9863344433114555665555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-34296IPR002100Transcription factor, MADS-box
CDDcd002658.07E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003197.4E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-262338IPR002100Transcription factor, MADS-box
Gene3DG3DSA:1.20.58.707.4E-436163No hitNo description
PRINTSPR004044.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014862.7E-1382156IPR002487Transcription factor, K-box
PROSITE profilePS5129712.18184166IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHESLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKVREHQA CRHLSEKMMV EENRQLSFQL QQQEMAIASN ARGMMMRDHD  180
GQFGYRVQPI QPNLQEKIMS LVID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-16289180Myocyte-specific enhancer factor 2A
3kov_B2e-16289180Myocyte-specific enhancer factor 2A
3kov_I2e-16289180Myocyte-specific enhancer factor 2A
3kov_J2e-16289180Myocyte-specific enhancer factor 2A
3p57_A2e-16289180Myocyte-specific enhancer factor 2A
3p57_B2e-16289180Myocyte-specific enhancer factor 2A
3p57_C2e-16289180Myocyte-specific enhancer factor 2A
3p57_D2e-16289180Myocyte-specific enhancer factor 2A
3p57_I2e-16289180Myocyte-specific enhancer factor 2A
3p57_J2e-16289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1594310.0EU159431.1 Brassica napus PISTILLATA-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010420863.11e-140PREDICTED: floral homeotic protein PISTILLATA
SwissprotP480071e-140PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLM4CQQ81e-141M4CQQ8_BRARP; Uncharacterized protein
STRINGBra006549.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-142MIKC_MADS family protein